Lineage for d5lnsa_ (5lns A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. Family c.1.2.0: automated matches [191350] (1 protein)
    not a true family
  6. Protein automated matches [190292] (36 species)
    not a true protein
  7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [323630] (11 PDB entries)
  8. Domain d5lnsa_: 5lns A: [328592]
    automated match to d3fema_
    complexed with 5rp, po4

Details for d5lnsa_

PDB Entry: 5lns (more details), 1.91 Å

PDB Description: crystal structure of arabidopsis thaliana pdx1-r5p complex
PDB Compounds: (A:) Pyridoxal 5'-phosphate synthase subunit PDX1.3

SCOPe Domain Sequences for d5lnsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lnsa_ c.1.2.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
spfsvkvglaqmlrggvimdvvnaeqariaeeagacavmalervpadiraqggvarmsdp
qmikeikqavtipvmakarighfveaqileaigidyidesevltladedhhinkhnfrip
fvcgcrnlgealrriregaamirtkgeagtgniieavrhvrsvngdirvlrnmdddevft
fakklaapydlvmqtkqlgrlpvvqfaaggvatpadaalmmqlgcdgvfvgsgifksgdp
arraraivqavthysdpemlvevscglgeamvgin

SCOPe Domain Coordinates for d5lnsa_ are not available.

Timeline for d5lnsa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5lnsb_, d5lnsc_, d5lnsd_