Lineage for d1aqxd2 (1aqx D:2-76)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 395822Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 395823Superfamily c.47.1: Thioredoxin-like [52833] (14 families) (S)
  5. 395996Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)
  6. 396206Protein Class pi GST [81358] (3 species)
  7. 396207Species Human (Homo sapiens) [TaxId:9606] [52864] (36 PDB entries)
  8. 396262Domain d1aqxd2: 1aqx D:2-76 [32859]
    Other proteins in same PDB: d1aqxa1, d1aqxb1, d1aqxc1, d1aqxd1
    complexed with ilg, mes, tnb

Details for d1aqxd2

PDB Entry: 1aqx (more details), 2 Å

PDB Description: glutathione s-transferase in complex with meisenheimer complex

SCOP Domain Sequences for d1aqxd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aqxd2 c.47.1.5 (D:2-76) Class pi GST {Human (Homo sapiens)}
pytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdlt
lyqsntilrhlgrtl

SCOP Domain Coordinates for d1aqxd2:

Click to download the PDB-style file with coordinates for d1aqxd2.
(The format of our PDB-style files is described here.)

Timeline for d1aqxd2: