Lineage for d5lddc_ (5ldd C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2871799Species Chaetomium thermophilum [TaxId:759272] [328588] (2 PDB entries)
  8. 2871802Domain d5lddc_: 5ldd C: [328589]
    automated match to d1ukvy_
    complexed with so4

Details for d5lddc_

PDB Entry: 5ldd (more details), 2.5 Å

PDB Description: crystal structure of the heterodimeric gef mon1-ccz1 in complex with ypt7
PDB Compounds: (C:) Rab small monomeric GTPase-like protein

SCOPe Domain Sequences for d5lddc_:

Sequence, based on SEQRES records: (download)

>d5lddc_ c.37.1.0 (C:) automated matches {Chaetomium thermophilum [TaxId: 759272]}
kkvllkviilgdsgvgktslmnqyvnkkfsasykatigadfltrevmvddrqvtmqlwdt
agqerfqslgvafyrgadccvlvfdvnnaksfdaldswrdefliqasprdpenfpfvvlg
ikidveeskrvistkraqtfcqskggipyfetsakeainveeafqviarnalmq

Sequence, based on observed residues (ATOM records): (download)

>d5lddc_ c.37.1.0 (C:) automated matches {Chaetomium thermophilum [TaxId: 759272]}
kkvllkviilgdsgvgktslmnqyvnkkfsasykatigadfltrevmvddrqvtmqlwdt
agqerfqslgvafyrgadccvlvfdvnnaksfdaldswrdefliqasprdpenfpfvvlg
ikikrvistkraqtfcqskggipyfetsakainveeafqviarnalmq

SCOPe Domain Coordinates for d5lddc_:

Click to download the PDB-style file with coordinates for d5lddc_.
(The format of our PDB-style files is described here.)

Timeline for d5lddc_: