SCOPe 2.08: Domain d5lddc_: 5ldd C:

Lineage for d5lddc_ (5ldd C:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Chaetomium thermophilum [TaxId:759272] [328588] (2 PDB entries)

8. Domain d5lddc_: 5ldd C: [328589]
   automated match to d1ukvy_
   complexed with so4

Details for d5lddc_

PDB Entry: 5ldd, 2.5 Å

PDB Description: crystal structure of the heterodimeric gef mon1-ccz1 in complex with ypt7

PDB Compounds: (C:) Rab small monomeric GTPase-like protein

SCOPe Domain Sequences for d5lddc_:

Sequence, based on SEQRES records:

>d5lddc_ c.37.1.0 (C:) automated matches {Chaetomium thermophilum [TaxId: 759272]}
kkvllkviilgdsgvgktslmnqyvnkkfsasykatigadfltrevmvddrqvtmqlwdt
agqerfqslgvafyrgadccvlvfdvnnaksfdaldswrdefliqasprdpenfpfvvlg
ikidveeskrvistkraqtfcqskggipyfetsakeainveeafqviarnalmq

Sequence, based on observed residues (ATOM records):

>d5lddc_ c.37.1.0 (C:) automated matches {Chaetomium thermophilum [TaxId: 759272]}
kkvllkviilgdsgvgktslmnqyvnkkfsasykatigadfltrevmvddrqvtmqlwdt
agqerfqslgvafyrgadccvlvfdvnnaksfdaldswrdefliqasprdpenfpfvvlg
ikikrvistkraqtfcqskggipyfetsakainveeafqviarnalmq

Timeline for d5lddc_:

• d5lddc_ first appeared in SCOPe 2.06
  
• d5lddc_ appears in SCOPe 2.07