![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.61: LigT-like [55143] (1 superfamily) duplication of beta-alpha-beta-alpha-beta motif: antiparallel beta sheet forms barrel (n=6, S=8) similar to the barrel of prokaryotic DNA topoisomerases I and III |
![]() | Superfamily d.61.1: LigT-like [55144] (5 families) ![]() |
![]() | Family d.61.1.0: automated matches [191492] (1 protein) not a true family |
![]() | Protein automated matches [190796] (6 species) not a true protein |
![]() | Species Escherichia coli [TaxId:469008] [328566] (7 PDB entries) |
![]() | Domain d5ldja_: 5ldj A: [328584] automated match to d4qakb_ complexed with po4 |
PDB Entry: 5ldj (more details), 2.8 Å
SCOPe Domain Sequences for d5ldja_:
Sequence, based on SEQRES records: (download)
>d5ldja_ d.61.1.0 (A:) automated matches {Escherichia coli [TaxId: 469008]} sepqrlffaidlpaeireqiihwrakhfppeagrpvaadnlhltlaflgevsaekekals llagrirqpgftltlddagqwlrsrvvwlgmrqpprgliqlanmlrsqaarsgcfqsnrp fhphitllrdaseavtipppgfnwsyavteftlyassfargrtrytplkrwaltq
>d5ldja_ d.61.1.0 (A:) automated matches {Escherichia coli [TaxId: 469008]} sepqrlffaidlpaeireqiihwrakhfppeagrpvaadnlhltlaflgevsaekekals llagrirqpgftltlddagqwlrsrvvwlgmrqpprgliqlanmlrsqaarpfhphitll rdaseavtipppgfnwsyavteftlyassfargrtrytplkrwaltq
Timeline for d5ldja_: