Lineage for d5ldod_ (5ldo D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2956563Fold d.61: LigT-like [55143] (1 superfamily)
    duplication of beta-alpha-beta-alpha-beta motif: antiparallel beta sheet forms barrel (n=6, S=8) similar to the barrel of prokaryotic DNA topoisomerases I and III
  4. 2956564Superfamily d.61.1: LigT-like [55144] (5 families) (S)
  5. 2956626Family d.61.1.0: automated matches [191492] (1 protein)
    not a true family
  6. 2956627Protein automated matches [190796] (6 species)
    not a true protein
  7. 2956633Species Escherichia coli [TaxId:469008] [328566] (7 PDB entries)
  8. 2956651Domain d5ldod_: 5ldo D: [328567]
    automated match to d4qakb_
    complexed with 3am

Details for d5ldod_

PDB Entry: 5ldo (more details), 2.75 Å

PDB Description: crystal structure of e.coli ligt complexed with 3'-amp
PDB Compounds: (D:) RNA 2',3'-cyclic phosphodiesterase

SCOPe Domain Sequences for d5ldod_:

Sequence, based on SEQRES records: (download)

>d5ldod_ d.61.1.0 (D:) automated matches {Escherichia coli [TaxId: 469008]}
sepqrlffaidlpaeireqiihwrakhfppeagrpvaadnlhltlaflgevsaekekals
llagrirqpgftltlddagqwlrsrvvwlgmrqpprgliqlanmlrsqaarsgcfqsnrp
fhphitllrdaseavtipppgfnwsyavteftlyassfargrtrytplkrwaltq

Sequence, based on observed residues (ATOM records): (download)

>d5ldod_ d.61.1.0 (D:) automated matches {Escherichia coli [TaxId: 469008]}
sepqrlffaidlpaeireqiihwrakhfppeagrpvaadnlhltlaflgevsaekekals
llagrirqpgftltlddagqwlrsrvvwlgmrqpprgliqlanmlrsqaarsgfhphitl
lrdaseavtipppgfnwsyavteftlyassfargrtrytplkrwaltq

SCOPe Domain Coordinates for d5ldod_:

Click to download the PDB-style file with coordinates for d5ldod_.
(The format of our PDB-style files is described here.)

Timeline for d5ldod_: