SCOPe 2.08: Domain d5hk0a_: 5hk0 A:

Lineage for d5hk0a_ (5hk0 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (4 families)
   contains insert beta-sheet subdomain and C-terminal helix

5. Family b.34.6.0: automated matches [328522] (1 protein)
   not a true family

6. Protein automated matches [328523] (5 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [328524] (7 PDB entries)

8. Domain d5hk0a_: 5hk0 A: [328563]
   automated match to d4of1a_
   protein/RNA complex

Details for d5hk0a_

PDB Entry: 5hk0, 2.25 Å

PDB Description: crystal structure of m. tuberculosis mazf-mt3 (rv1991c) in complex with rna

PDB Compounds: (A:) Endoribonuclease MazF6

SCOPe Domain Sequences for d5hk0a_:

Sequence, based on SEQRES records:

>d5hk0a_ b.34.6.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mvisraeiywadlgppsgsqpakrrpvlviqsdpynasrlatviaavitsntalaampgn
vflpatttrlprdsvvnvtaivtlnktdltdrvgevpaslmhevdrglrrvldl

Sequence, based on observed residues (ATOM records):

>d5hk0a_ b.34.6.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mvisraeiywadlgppakrrpvlviqsdpynasrlatviaavitsntalaampgnvflpa
tttrlprdsvvnvtaivtlnktdltdrvgevpaslmhevdrglrrvldl

Timeline for d5hk0a_:

• d5hk0a_ first appeared in SCOPe 2.06
  
• d5hk0a_ appears in SCOPe 2.07