Lineage for d5hjyc2 (5hjy C:139-453)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) 
automatically mapped to Pfam PF00016Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
N-terminal domain is alpha+beta
Protein automated matches [226984] (16 species)
not a true protein
Species Rhodopseudomonas palustris [TaxId:1076] [327791] (7 PDB entries) 
Domain d5hjyc2: 5hjy C:139-453 [328555]
Other proteins in same PDB: d5hjya1, d5hjyb1, d5hjyc1, d5hjyd1, d5hjye1, d5hjyf1
automated match to d4lf2a2
complexed with cap, cl, mg; mutant
Details for d5hjyc2
PDB Entry: 5hjy (more details), 2.3 Å
PDB Description: structure function studies of r. palustris rubisco (i165t mutant; cabp-bound)
PDB Compounds: (C:) Ribulose bisphosphate carboxylaseSCOPe Domain Sequences for d5hjyc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hjyc2 c.1.14.1 (C:139-453) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}
gpsttikdlwrvlgrpvinggfivgttikpklglrpqpfanacydfwlggdfikndepqg
nqvfapfkdtvravadamrraqdktgeaklfsfnitaddhyemlargefiletfadnadh
iaflvdgyvagpaavttarrafpkqylhyhraghgavtspqskrgytafvlskmarlqga
sgihtgtmgfgkmegeaadraiaymitedaadgpyfhqewlgmnpttpiisggmnalrmp
gffdnlghsnlimtagggafghvdggaagakslrqaeqcwkqgadpvefakdhrefaraf
esfpqdadklypnwr
SCOPe Domain Coordinates for d5hjyc2:
Click to download the PDB-style file with coordinates for d5hjyc2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5hjyc2:
View in 3D
