Lineage for d5hh5a_ (5hh5 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2602905Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2602906Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2602907Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2603069Protein automated matches [190079] (12 species)
    not a true protein
  7. 2603297Species Stenotrophomonas maltophilia [TaxId:40324] [186946] (8 PDB entries)
  8. 2603304Domain d5hh5a_: 5hh5 A: [328545]
    automated match to d2fu9a_
    complexed with 60m, gol, so4, zn

Details for d5hh5a_

PDB Entry: 5hh5 (more details), 1.8 Å

PDB Description: crystal structure of b3 metallo-beta-lactamase l1 complexed with a phosphonate-based inhibitor
PDB Compounds: (A:) Metallo-beta-lactamase L1

SCOPe Domain Sequences for d5hh5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hh5a_ d.157.1.1 (A:) automated matches {Stenotrophomonas maltophilia [TaxId: 40324]}
evplpqlraytvdaswlqpmaplqiadhtwqigtedltallvqtpdgavlldggmpqmas
hlldnmkargvtprdlrlillshahadhagpvaelkrrtgakvaanaesavllarggsdd
lhfgdgityppanadrivmdgevitvggivftahfmaghtpgstawtwtdtrngkpvria
yadslsapgyqlqgnpryphliedyrrsfatvralpcdvlltphpgasnwdyaagaraga
kaltckayadaaeqkfdgqlaketag

SCOPe Domain Coordinates for d5hh5a_:

Click to download the PDB-style file with coordinates for d5hh5a_.
(The format of our PDB-style files is described here.)

Timeline for d5hh5a_: