SCOPe 2.08: Domain d5izza_: 5izz A:

Lineage for d5izza_ (5izz A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (161 species)
   not a true protein

7. Species Uncultured bacterium [TaxId:77133] [328538] (2 PDB entries)

8. Domain d5izza_: 5izz A: [328539]
   automated match to d5im2a_
   complexed with 3hp, peg; mutant

Details for d5izza_

PDB Entry: 5izz, 1.6 Å

PDB Description: crystal structure of a marine metagenome trap solute binding protein specific for aromatic acid ligands (sorcerer ii global ocean sampling expedition, unidentified microbe, locus tag gos_1523157, triple surface mutant k158a_k223a_k313a) in complex with metahydroxyphenylacetate, thermal exchange of ligand

PDB Compounds: (A:) trap transporter solute binding protein

SCOPe Domain Sequences for d5izza_:

Sequence; same for both SEQRES and ATOM records:

>d5izza_ c.94.1.0 (A:) automated matches {Uncultured bacterium [TaxId: 77133]}
evvlkfhsfppmpansnakfvkpwsekvlaesngeikveiypamqlggkppqlvdqvrdg
vvdivwtvagytpgrfphleafelpfmpasaeatsqalqeyvdtvaasdlkdykvlavfc
hapgkihtkekviasaadlngmkmrgptrvitkmleglgatpvgmpvpavagalskgvid
gmvvpweimpsfklheltaahttvsgsrglyttpflflmnkakyeslsdehkkvidnnag
lalaklagqlwdgfevparklaldaggtihslsggplaemkaagegleadwiksandrgl
dgamlvktakdliskydk

Timeline for d5izza_:

• d5izza_ first appeared in SCOPe 2.06
  
• d5izza_ appears in SCOPe 2.07