Lineage for d5hd8f2 (5hd8 F:107-211)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2753374Domain d5hd8f2: 5hd8 F:107-211 [328536]
    Other proteins in same PDB: d5hd8a_, d5hd8b_, d5hd8c_, d5hd8d1, d5hd8e_, d5hd8f1
    automated match to d1ikfl2
    complexed with cl

Details for d5hd8f2

PDB Entry: 5hd8 (more details), 3.15 Å

PDB Description: crystal structure of disulfide cross-linked d417c clc-ec1
PDB Compounds: (F:) Fab Fragment (Light Chain)

SCOPe Domain Sequences for d5hd8f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hd8f2 b.1.1.2 (F:107-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnra

SCOPe Domain Coordinates for d5hd8f2:

Click to download the PDB-style file with coordinates for d5hd8f2.
(The format of our PDB-style files is described here.)

Timeline for d5hd8f2: