| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
| Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
| Protein automated matches [190039] (161 species) not a true protein |
| Species Uncultured marine [TaxId:56765] [328526] (2 PDB entries) |
| Domain d5i5pa1: 5i5p A:25-342 [328527] Other proteins in same PDB: d5i5pa2, d5i5pb2 automated match to d5im2a_ complexed with br, peg, phb |
PDB Entry: 5i5p (more details), 1.6 Å
SCOPe Domain Sequences for d5i5pa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5i5pa1 c.94.1.0 (A:25-342) automated matches {Uncultured marine [TaxId: 56765]}
evvlkfhsfppmpansnakfvkpwsekvlaesngeikveiypamqlggkppqlvdqvrdg
vvdivwtvagytpgrfphleafelpfmpasaeatsqalqeyvdtvaasdlkdykvlavfc
hapgkihtkekviksaadlngmkmrgptrvitkmleglgatpvgmpvpavagalskgvid
gmvvpweimpsfklheltkahttvsgsrglyttpflflmnkakyeslsdehkkvidnnag
lalaklagqlwdgfevparklaldaggtihslsggplaemkaageglekdwiksandrgl
dgamlvktakdliskydk
Timeline for d5i5pa1: