Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily) duplication: consists of 3 similar intertwined domains structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta |
Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) |
Family d.130.1.0: automated matches [254267] (1 protein) not a true family |
Protein automated matches [254617] (10 species) not a true protein |
Species Thermus thermophilus [TaxId:262724] [328462] (1 PDB entry) |
Domain d5h9uc2: 5h9u C:119-244 [328520] automated match to d4odja2 |
PDB Entry: 5h9u (more details), 2.67 Å
SCOPe Domain Sequences for d5h9uc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5h9uc2 d.130.1.0 (C:119-244) automated matches {Thermus thermophilus [TaxId: 262724]} stdpldrvgagdqglmfgyatdetpelmplpitlahrltmrlaevrktgllpylrpdgka qvtvvyegdkplyvktvvvsaqhspeveqeqlredlirevvrqaippeylkdgeteylin psgrfi
Timeline for d5h9uc2: