Lineage for d5h9uc2 (5h9u C:119-244)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2215558Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 2215559Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. 2215664Family d.130.1.0: automated matches [254267] (1 protein)
    not a true family
  6. 2215665Protein automated matches [254617] (10 species)
    not a true protein
  7. 2215779Species Thermus thermophilus [TaxId:262724] [328462] (1 PDB entry)
  8. 2215787Domain d5h9uc2: 5h9u C:119-244 [328520]
    automated match to d4odja2

Details for d5h9uc2

PDB Entry: 5h9u (more details), 2.67 Å

PDB Description: crystal structure of a thermostable methionine adenosyltransferase
PDB Compounds: (C:) S-adenosylmethionine synthase

SCOPe Domain Sequences for d5h9uc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h9uc2 d.130.1.0 (C:119-244) automated matches {Thermus thermophilus [TaxId: 262724]}
stdpldrvgagdqglmfgyatdetpelmplpitlahrltmrlaevrktgllpylrpdgka
qvtvvyegdkplyvktvvvsaqhspeveqeqlredlirevvrqaippeylkdgeteylin
psgrfi

SCOPe Domain Coordinates for d5h9uc2:

Click to download the PDB-style file with coordinates for d5h9uc2.
(The format of our PDB-style files is described here.)

Timeline for d5h9uc2: