![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.23: CUB-like [49853] (3 superfamilies) sandwich, 10 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.23.1: Spermadhesin, CUB domain [49854] (2 families) ![]() automatically mapped to Pfam PF00431 |
![]() | Family b.23.1.1: Spermadhesin, CUB domain [49855] (6 proteins) |
![]() | Protein automated matches [328442] (1 species) not a true protein |
![]() | Species Rattus norvegicus [TaxId:10116] [328443] (3 PDB entries) |
![]() | Domain d5ckna1: 5ckn A:1-119 [328509] Other proteins in same PDB: d5ckna2, d5cknd2 automated match to d1nt0a1 complexed with ca |
PDB Entry: 5ckn (more details), 2.6 Å
SCOPe Domain Sequences for d5ckna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ckna1 b.23.1.1 (A:1-119) automated matches {Rattus norvegicus [TaxId: 10116]} skwpepvfgrlvspgfpekygnhqdrswtltappgfrlrlyfthfnlelsyrceydfvkl tsgtkvlatlcgqestdterapgndtfyslgpslkvtfhsdysnekpftgfeafyaaed
Timeline for d5ckna1: