Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) C-terminal domain is beta/alpha barrel |
Family d.58.9.0: automated matches [227234] (1 protein) not a true family |
Protein automated matches [226983] (18 species) not a true protein |
Species Rhodopseudomonas palustris [TaxId:1076] [327788] (7 PDB entries) |
Domain d5hjyb1: 5hjy B:1-138 [328500] Other proteins in same PDB: d5hjya2, d5hjyb2, d5hjyc2, d5hjyd2, d5hjye2, d5hjyf2 automated match to d4lf2a1 complexed with cap, cl, mg; mutant |
PDB Entry: 5hjy (more details), 2.3 Å
SCOPe Domain Sequences for d5hjyb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hjyb1 d.58.9.0 (B:1-138) automated matches {Rhodopseudomonas palustris [TaxId: 1076]} mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfaaesstgtnvevst tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve yakmydfyvppaylklfd
Timeline for d5hjyb1: