Lineage for d5hkwb1 (5hkw B:48-177)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2714566Fold a.48: N-cbl like [47667] (5 superfamilies)
    4 helices; bundle, left-handed twist; left-handed superhelix
  4. 2714567Superfamily a.48.1: N-terminal domain of cbl (N-cbl) [47668] (2 families) (S)
    automatically mapped to Pfam PF02262
  5. 2714568Family a.48.1.1: N-terminal domain of cbl (N-cbl) [47669] (1 protein)
  6. 2714569Protein N-terminal domain of cbl (N-cbl) [47670] (1 species)
  7. 2714570Species Human (Homo sapiens) [TaxId:9606] [47671] (13 PDB entries)
  8. 2714587Domain d5hkwb1: 5hkw B:48-177 [328495]
    Other proteins in same PDB: d5hkwa2, d5hkwa3, d5hkwb2, d5hkwb3, d5hkwc2, d5hkwc3
    automated match to d2cbla2
    complexed with na

Details for d5hkwb1

PDB Entry: 5hkw (more details), 2.25 Å

PDB Description: crystal structure of apo c-cbl tkbd refined to 2.25 a resolution
PDB Compounds: (B:) E3 ubiquitin-protein ligase CBL

SCOPe Domain Sequences for d5hkwb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hkwb1 a.48.1.1 (B:48-177) N-terminal domain of cbl (N-cbl) {Human (Homo sapiens) [TaxId: 9606]}
pgtvdkkmvekcwklmdkvvrlcqnpklalknsppyildllpdtyqhlrtilsryegkme
tlgeneyfrvfmenlmkktkqtislfkegkermyeensqprrnltklslifshmlaelkg
ifpsglfqgd

SCOPe Domain Coordinates for d5hkwb1:

Click to download the PDB-style file with coordinates for d5hkwb1.
(The format of our PDB-style files is described here.)

Timeline for d5hkwb1: