Lineage for d5h3ab_ (5h3a B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. Protein automated matches [190469] (17 species)
    not a true protein
  7. Species Human herpesvirus 8 [TaxId:37296] [328471] (3 PDB entries)
  8. Domain d5h3ab_: 5h3a B: [328493]
    automated match to d1hvya_
    complexed with d16, ump

Details for d5h3ab_

PDB Entry: 5h3a (more details), 2.4 Å

PDB Description: structural analysis of kshv thymidylate synthase
PDB Compounds: (B:) orf70

SCOPe Domain Sequences for d5h3ab_:

Sequence, based on SEQRES records: (download)

>d5h3ab_ d.117.1.1 (B:) automated matches {Human herpesvirus 8 [TaxId: 37296]}
pheelqylrqlreilcrgsdrldrtgigtlslfgmqaryslrdhfpllttkrvfwrgvvq
ellwflkgstdsrelsrtgvkiwdkngsreflagrglahrregdlgpvygfqwrhfgaay
vdadadytgqgfdqlsyivdliknnphdrriimcawnpadlslmalppchllcqfyvadg
elscqlyqrsgdmglgvpfniasyslltymlahvtglrpgefihtlgdahiykthieplr
lqltrtprpfprleilrsvssmeeftpddfrlvdycphptirm

Sequence, based on observed residues (ATOM records): (download)

>d5h3ab_ d.117.1.1 (B:) automated matches {Human herpesvirus 8 [TaxId: 37296]}
pheelqylrqlreilcrgsdrltgigtlslfgmqaryslrdhfpllttkrvfwrgvvqel
lwflkgstdsrelsrtgvkiwdkngsreflagrglahrregdlgpvygfqwrhfgaayvd
adadytgqgfdqlsyivdliknnphdrriimcawnpadlslmalppchllcqfyvadgel
scqlyqrsgdmglgvpfniasyslltymlahvtglrpgefihtlgdahiykthieplrlq
ltrtprpfprleilrsvssmeeftpddfrlvdycphptirm

SCOPe Domain Coordinates for d5h3ab_ are not available.

Timeline for d5h3ab_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5h3aa_