![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) ![]() |
![]() | Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
![]() | Protein automated matches [190689] (87 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [187843] (21 PDB entries) |
![]() | Domain d5fqoa_: 5fqo A: [328489] automated match to d5egsd_ complexed with mg, sah |
PDB Entry: 5fqo (more details), 1.9 Å
SCOPe Domain Sequences for d5fqoa_:
Sequence, based on SEQRES records: (download)
>d5fqoa_ c.66.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} lyyecysdvsvheemiadqvrteayrlgilknwaalrgktvldvgagtgilsifcaqaga rrvyaveasaiwqqarevvrlngledrvhvlpgpvetvelpervdaivsewmgygllhes mlssvlhartkwlkegglllpasaelfvapisdqmlewrlgfwsqvkqhygvdmscmesf atrclmghseivvqdlsgedvlarpqrfaqlelaragleqeleagvggrfrcscygsapl hgfavwfqvtfpggdsekplvlstsplhpathwkqallylnepvpveqdtdisgeitllp spdnprrlrillrykvgdheektkdfame
>d5fqoa_ c.66.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} lyyecysdvsvheemiadqvrteayrlgilknwaalrgktvldvgagtgilsifcaqaga rrvyaveasaiwqqarevvrlngledrvhvlpgpvetvelpervdaivsewmgygllhes mlssvlhartkwlkegglllpasaelfvapisdqmlewrlgfwsqvkqhygvdmscmesf atrclmghseivvqdlsgedvlarpqrfaqlelaragleqeleagvggrfrcscygsapl hgfavwfqvtfpgplvlstsplhpathwkqallylnepvpveqdtdisgeitllpspdnp rrlrillrykvgdheektkdfame
Timeline for d5fqoa_: