| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) ![]() |
| Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins) |
| Protein ATX1 metallochaperone protein (ATOX1) [55014] (3 species) |
| Species Human (Homo sapiens), HAH1 [TaxId:9606] [55016] (17 PDB entries) Uniprot O00244 |
| Domain d5f0wc_: 5f0w C: [328486] automated match to d1fe0b_ complexed with ag |
PDB Entry: 5f0w (more details), 2.7 Å
SCOPe Domain Sequences for d5f0wc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5f0wc_ d.58.17.1 (C:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]}
mpkhefsvdmtcggcaeavsrvlnklggvkydidlpnkkvciesehsmdtllatlkktgk
tvsylgle
Timeline for d5f0wc_: