Lineage for d5cisa2 (5cis A:120-164)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2635893Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2636580Family g.3.11.0: automated matches [227227] (1 protein)
    not a true family
  6. 2636581Protein automated matches [226968] (4 species)
    not a true protein
  7. 2636642Species Norway rat (Rattus norvegicus) [TaxId:10116] [270149] (4 PDB entries)
  8. 2636649Domain d5cisa2: 5cis A:120-164 [328475]
    Other proteins in same PDB: d5cisa1, d5cisa3
    automated match to d1nt0a3
    complexed with ca, nag

Details for d5cisa2

PDB Entry: 5cis (more details), 2.58 Å

PDB Description: the cub1-egf-cub2 domains of rat mbl-associated serine protease-2 (masp-2) bound to ca2+
PDB Compounds: (A:) Mannan-binding lectin serine peptidase 2

SCOPe Domain Sequences for d5cisa2:

Sequence, based on SEQRES records: (download)

>d5cisa2 g.3.11.0 (A:120-164) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vdecrtslgdsvpcdhychnylggyycscrvgyilhqnkhtcsal

Sequence, based on observed residues (ATOM records): (download)

>d5cisa2 g.3.11.0 (A:120-164) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vdecrtsdsvpcdhychnylggyycscrvgyilhqnkhtcsal

SCOPe Domain Coordinates for d5cisa2:

Click to download the PDB-style file with coordinates for d5cisa2.
(The format of our PDB-style files is described here.)

Timeline for d5cisa2: