Lineage for d5cisa1 (5cis A:2-119)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777703Fold b.23: CUB-like [49853] (3 superfamilies)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2777704Superfamily b.23.1: Spermadhesin, CUB domain [49854] (2 families) (S)
    automatically mapped to Pfam PF00431
  5. 2777705Family b.23.1.1: Spermadhesin, CUB domain [49855] (6 proteins)
  6. 2777739Protein automated matches [328442] (1 species)
    not a true protein
  7. 2777740Species Norway rat (Rattus norvegicus) [TaxId:10116] [328443] (3 PDB entries)
  8. 2777741Domain d5cisa1: 5cis A:2-119 [328474]
    Other proteins in same PDB: d5cisa2
    automated match to d1nt0a1
    complexed with ca, nag

Details for d5cisa1

PDB Entry: 5cis (more details), 2.58 Å

PDB Description: the cub1-egf-cub2 domains of rat mbl-associated serine protease-2 (masp-2) bound to ca2+
PDB Compounds: (A:) Mannan-binding lectin serine peptidase 2

SCOPe Domain Sequences for d5cisa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cisa1 b.23.1.1 (A:2-119) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kwpepvfgrlvspgfpekygnhqdrswtltappgfrlrlyfthfnlelsyrceydfvklt
sgtkvlatlcgqestdterapgndtfyslgpslkvtfhsdysnekpftgfeafyaaed

SCOPe Domain Coordinates for d5cisa1:

Click to download the PDB-style file with coordinates for d5cisa1.
(The format of our PDB-style files is described here.)

Timeline for d5cisa1: