| Class b: All beta proteins [48724] (180 folds) |
| Fold b.23: CUB-like [49853] (3 superfamilies) sandwich, 10 strands in 2 sheets; jelly-roll |
Superfamily b.23.1: Spermadhesin, CUB domain [49854] (2 families) ![]() automatically mapped to Pfam PF00431 |
| Family b.23.1.1: Spermadhesin, CUB domain [49855] (6 proteins) |
| Protein automated matches [328442] (1 species) not a true protein |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [328443] (3 PDB entries) |
| Domain d5cisa1: 5cis A:2-119 [328474] Other proteins in same PDB: d5cisa2 automated match to d1nt0a1 complexed with ca, nag |
PDB Entry: 5cis (more details), 2.58 Å
SCOPe Domain Sequences for d5cisa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cisa1 b.23.1.1 (A:2-119) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kwpepvfgrlvspgfpekygnhqdrswtltappgfrlrlyfthfnlelsyrceydfvklt
sgtkvlatlcgqestdterapgndtfyslgpslkvtfhsdysnekpftgfeafyaaed
Timeline for d5cisa1: