![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily) contains large mixed beta-sheet |
![]() | Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) ![]() automatically mapped to Pfam PF00303 |
![]() | Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins) |
![]() | Protein automated matches [190469] (17 species) not a true protein |
![]() | Species Human herpesvirus 8 [TaxId:37296] [328471] (3 PDB entries) |
![]() | Domain d5h39a_: 5h39 A: [328472] automated match to d1hvya_ complexed with ump |
PDB Entry: 5h39 (more details), 2 Å
SCOPe Domain Sequences for d5h39a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5h39a_ d.117.1.1 (A:) automated matches {Human herpesvirus 8 [TaxId: 37296]} pheelqylrqlreilcrgsdrldrtgigtlslfgmqaryslrdhfpllttkrvfwrgvvq ellwflkgstdsrelsrtgvkiwdkngsreflagrglahrregdlgpvygfqwrhfgaay vdadadytgqgfdqlsyivdliknnphdrriimcawnpadlslmalppchllcqfyvadg elscqlyqrsgdmglgvpfniasyslltymlahvtglrpgefihtlgdahiykthieplr lqltrtprpfprleilrsvssmeeftpddfrlvdycphptirmem
Timeline for d5h39a_: