SCOPe 2.08: Domain d5gzoa2: 5gzo A:304-405

Lineage for d5gzoa2 (5gzo A:304-405)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (81 species)
   not a true protein

7. Species Zika virus [TaxId:64320] [317280] (7 PDB entries)

8. Domain d5gzoa2: 5gzo A:304-405 [328460]
   Other proteins in same PDB: d5gzoa1, d5gzob1, d5gzoc1, d5gzoc2, d5gzod1, d5gzod2, d5gzoh1, d5gzoh2, d5gzol1, d5gzol2
   automated match to d4gsxa2

Details for d5gzoa2

PDB Entry: 5gzo, 2.76 Å

PDB Description: structure of neutralizing antibody bound to zika envelope protein

PDB Compounds: (A:) Genome polyprotein

SCOPe Domain Sequences for d5gzoa2:

Sequence; same for both SEQRES and ATOM records:

>d5gzoa2 b.1.18.0 (A:304-405) automated matches {Zika virus [TaxId: 64320]}
syslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlitanp
vitestenskmmleldppfgdsyivigvgekkithhwhrsgs

Timeline for d5gzoa2:

• d5gzoa2 first appeared in SCOPe 2.06
  
• d5gzoa2 appears in SCOPe 2.07