Lineage for d5gzoa2 (5gzo A:304-405)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766609Species Zika virus [TaxId:64320] [317280] (7 PDB entries)
  8. 2766618Domain d5gzoa2: 5gzo A:304-405 [328460]
    Other proteins in same PDB: d5gzoa1, d5gzob1, d5gzoc1, d5gzoc2, d5gzod1, d5gzod2, d5gzoh1, d5gzoh2, d5gzol1, d5gzol2
    automated match to d4gsxa2

Details for d5gzoa2

PDB Entry: 5gzo (more details), 2.76 Å

PDB Description: structure of neutralizing antibody bound to zika envelope protein
PDB Compounds: (A:) Genome polyprotein

SCOPe Domain Sequences for d5gzoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gzoa2 b.1.18.0 (A:304-405) automated matches {Zika virus [TaxId: 64320]}
syslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlitanp
vitestenskmmleldppfgdsyivigvgekkithhwhrsgs

SCOPe Domain Coordinates for d5gzoa2:

Click to download the PDB-style file with coordinates for d5gzoa2.
(The format of our PDB-style files is described here.)

Timeline for d5gzoa2: