Lineage for d5gssa2 (5gss A:2-76)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1600407Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1600408Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1600814Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 1601129Protein Class pi GST [81358] (4 species)
  7. 1601130Species Human (Homo sapiens) [TaxId:9606] [52864] (49 PDB entries)
  8. 1601224Domain d5gssa2: 5gss A:2-76 [32846]
    Other proteins in same PDB: d5gssa1, d5gssb1
    complexed with gsh, mes

Details for d5gssa2

PDB Entry: 5gss (more details), 1.95 Å

PDB Description: human glutathione s-transferase p1-1, complex with glutathione
PDB Compounds: (A:) glutathione s-transferase p1-1

SCOPe Domain Sequences for d5gssa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gssa2 c.47.1.5 (A:2-76) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
pytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdlt
lyqsntilrhlgrtl

SCOPe Domain Coordinates for d5gssa2:

Click to download the PDB-style file with coordinates for d5gssa2.
(The format of our PDB-style files is described here.)

Timeline for d5gssa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5gssa1