Lineage for d5gzoa1 (5gzo A:1-303)

  1. Root: SCOPe 2.08
  2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
    2 intertwined domains; all-beta and alpha+beta
  4. Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) (S)
  5. Family f.10.1.0: automated matches [227258] (1 protein)
    not a true family
  6. Protein automated matches [227047] (11 species)
    not a true protein
  7. Species Zika virus [TaxId:64320] [317278] (7 PDB entries)
  8. Domain d5gzoa1: 5gzo A:1-303 [328459]
    Other proteins in same PDB: d5gzoa2, d5gzob2, d5gzoc1, d5gzoc2, d5gzod1, d5gzod2, d5gzoh1, d5gzoh2, d5gzol1, d5gzol2
    automated match to d4gsxa1

Details for d5gzoa1

PDB Entry: 5gzo (more details), 2.7600000000000002 Å

PDB Description: structure of neutralizing antibody bound to zika envelope protein
PDB Compounds: (A:) Genome polyprotein

SCOPe Domain Sequences for d5gzoa1:

Sequence, based on SEQRES records: (download)

>d5gzoa1 f.10.1.0 (A:1-303) automated matches {Zika virus [TaxId: 64320]}
ircigvsnrdfvegmsggtwvdvvlehggcvtvmaqdkptvdielvtttvsnmaevrsyc
yeasisdmasdsrcptqgeayldkqsdtqyvckrtlvdrgwgngcglfgkgslvtcakfa
cskkmtgksiqpenleyrimlsvhgsqhsgmivndtghetdenrakveitpnspraeatl
ggfgslgldceprtgldfsdlyyltmnnkhwlvhkewfhdiplpwhagadtgtphwnnke
alvefkdahakrqtvvvlgsqegavhtalagaleaemdgakgrlssghlkcrlkmdklrl
kgv

Sequence, based on observed residues (ATOM records): (download)

>d5gzoa1 f.10.1.0 (A:1-303) automated matches {Zika virus [TaxId: 64320]}
ircigvsnrdfvegmsggtwvdvvlehggcvtvmaqdkptvdielvtttvsnmaevrsyc
yeasisdmasdsrcptqgeayldkqsdtqyvckrtlvdrgwgngcglfgkgslvtcakfa
cskkmtgksiqpenleyrimlsvhgsenrakveitpnspraeatlggfgslgldceprtg
ldfsdlyyltmnnkhwlvhkewfhdiplpwhagadtgtphwnnkealvefkdahakrqtv
vvlgsqegavhtalagaleaemdgakgrlssghlkcrlkmdklrlkgv

SCOPe Domain Coordinates for d5gzoa1 are not available.

Timeline for d5gzoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5gzoa2
View in 3D
Domains from other chains:
(mouse over for more information)
d5gzob1, d5gzob2, d5gzoc1, d5gzoc2, d5gzod1, d5gzod2, d5gzoh1, d5gzoh2, d5gzol1, d5gzol2