Lineage for d5ckma2 (5ckm A:120-164)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2635893Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2636580Family g.3.11.0: automated matches [227227] (1 protein)
    not a true family
  6. 2636581Protein automated matches [226968] (4 species)
    not a true protein
  7. 2636642Species Norway rat (Rattus norvegicus) [TaxId:10116] [270149] (4 PDB entries)
  8. 2636652Domain d5ckma2: 5ckm A:120-164 [328452]
    Other proteins in same PDB: d5ckma1, d5ckma3
    automated match to d1nt0a3
    complexed with ca, nag

Details for d5ckma2

PDB Entry: 5ckm (more details), 2.73 Å

PDB Description: the cub1-egf-cub2 domains of rat mbl-associated serine protease-2 (masp-2) bound to ca2+
PDB Compounds: (A:) Mannan-binding lectin serine peptidase 2

SCOPe Domain Sequences for d5ckma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ckma2 g.3.11.0 (A:120-164) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vdecrtslgdsvpcdhychnylggyycscrvgyilhqnkhtcsal

SCOPe Domain Coordinates for d5ckma2:

Click to download the PDB-style file with coordinates for d5ckma2.
(The format of our PDB-style files is described here.)

Timeline for d5ckma2: