![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.23: CUB-like [49853] (3 superfamilies) sandwich, 10 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.23.1: Spermadhesin, CUB domain [49854] (2 families) ![]() automatically mapped to Pfam PF00431 |
![]() | Family b.23.1.1: Spermadhesin, CUB domain [49855] (6 proteins) |
![]() | Protein automated matches [328442] (1 species) not a true protein |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [328443] (3 PDB entries) |
![]() | Domain d5cknd3: 5ckn D:165-278 [328450] Other proteins in same PDB: d5ckna2, d5cknd2 automated match to d1nt0a2 complexed with ca |
PDB Entry: 5ckn (more details), 2.6 Å
SCOPe Domain Sequences for d5cknd3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cknd3 b.23.1.1 (D:165-278) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} csgqvftgrsgflsspeypqpypklsscaynirleegfsitldfvesfdvemhpeaqcpy dslkiqtdkreygpfcgktlpprietdsnkvtitfttdesgnhtgwkihytsta
Timeline for d5cknd3: