SCOPe 2.05: Domain d3pgtb2: 3pgt B:1-76

Lineage for d3pgtb2 (3pgt B:1-76)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class pi GST [81358] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52864] (49 PDB entries)

8. Domain d3pgtb2: 3pgt B:1-76 [32845]
   Other proteins in same PDB: d3pgta1, d3pgtb1
   complexed with gbx, mes, so4

Details for d3pgtb2

PDB Entry: 3pgt, 2.14 Å

PDB Description: crystal structure of hgstp1-1[i104] complexed with the gsh conjugate of (+)-anti-bpde

PDB Compounds: (B:) protein (glutathione s-transferase)

SCOPe Domain Sequences for d3pgtb2:

Sequence; same for both SEQRES and ATOM records:

>d3pgtb2 c.47.1.5 (B:1-76) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
tlyqsntilrhlgrtl

Timeline for d3pgtb2:

• d3pgtb2 first appeared (with stable ids) in SCOP 1.55
  
• d3pgtb2 appears in SCOPe 2.04
  
• d3pgtb2 appears in SCOPe 2.06
  
• d3pgtb2 appears in the current release, SCOPe 2.08