Lineage for d5f0wb_ (5f0w B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2560728Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) (S)
  5. 2560729Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins)
  6. 2560730Protein ATX1 metallochaperone protein (ATOX1) [55014] (3 species)
  7. 2560749Species Human (Homo sapiens), HAH1 [TaxId:9606] [55016] (15 PDB entries)
    Uniprot O00244
  8. 2560766Domain d5f0wb_: 5f0w B: [328449]
    automated match to d1fe0b_
    complexed with ag

Details for d5f0wb_

PDB Entry: 5f0w (more details), 2.7 Å

PDB Description: crystal structure of human copper homeostatic proteins atox1
PDB Compounds: (B:) copper transport protein atox1

SCOPe Domain Sequences for d5f0wb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f0wb_ d.58.17.1 (B:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]}
mpkhefsvdmtcggcaeavsrvlnklggvkydidlpnkkvciesehsmdtllatlkktgk
tvsylgle

SCOPe Domain Coordinates for d5f0wb_:

Click to download the PDB-style file with coordinates for d5f0wb_.
(The format of our PDB-style files is described here.)

Timeline for d5f0wb_: