SCOPe 2.07: Domain d5tepa2: 5tep A:430-552

Lineage for d5tepa2 (5tep A:430-552)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (16 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (40 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 group m subtype b (isolate bh10) [TaxId:11678] [275362] (22 PDB entries)

8. Domain d5tepa2: 5tep A:430-552 [328435]
   Other proteins in same PDB: d5tepa1, d5tepb_
   automated match to d1dloa1
   protein/DNA complex; complexed with 7ax

Details for d5tepa2

PDB Entry: 5tep, 3.1 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase in complex with 7-(2- (2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)-2- naphthonitrile (jlj649), a non-nucleoside inhibitor

PDB Compounds: (A:) HIV-1 reverse transcriptase, p66 subunit

SCOPe Domain Sequences for d5tepa2:

Sequence; same for both SEQRES and ATOM records:

>d5tepa2 c.55.3.0 (A:430-552) automated matches {Human immunodeficiency virus type 1 group m subtype b (isolate bh10) [TaxId: 11678]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klv

Timeline for d5tepa2:

• d5tepa2 first appeared in SCOPe 2.06
  
• d5tepa2 does not appear in SCOPe 2.08