![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
![]() | Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) ![]() |
![]() | Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
![]() | Protein automated matches [190151] (166 species) not a true protein |
![]() | Species Campylobacter jejuni [TaxId:197] [189298] (7 PDB entries) |
![]() | Domain d5u21c1: 5u21 C:1-360 [328399] Other proteins in same PDB: d5u21a2, d5u21b2, d5u21c2, d5u21d2 automated match to d2ogeb_ complexed with cl, edo, na, tqp; mutant |
PDB Entry: 5u21 (more details), 1.6 Å
SCOPe Domain Sequences for d5u21c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5u21c1 c.67.1.0 (C:1-360) automated matches {Campylobacter jejuni [TaxId: 197]} mfflnlkqindrfntefitkfkeilesgwyilgkqcekfennfakycgvkhcigvangld alrliikaydfkendeiivpantyiasilaitdnkckpiliepdintyninpdlieekit kktkaimvvhlygqvcdmekiqllankynlkiiedcaqahgaiykdkrvgnlgdaagfsf ypganlgalgdagcictnddnfaskiralanygshkkyenlytglnsrldeiqaafldik lkyldednnkrknianfylqnikneniilpsnkfdhvwhlfvvktklrdelqhylnnhdi qtiihypipphkqkcykdlnhlklpitenihqevlslpisptmkendfkkvadilnkwkv
Timeline for d5u21c1: