Lineage for d5u7ab1 (5u7a B:1-80)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694465Family a.4.5.79: MerB N-terminal domain-like [158323] (1 protein)
  6. 2694466Protein Alkylmercury lyase MerB [158324] (1 species)
  7. 2694467Species Escherichia coli [TaxId:562] [158325] (17 PDB entries)
    Uniprot P77072 21-80
  8. 2694477Domain d5u7ab1: 5u7a B:1-80 [328387]
    Other proteins in same PDB: d5u7aa2, d5u7ab2
    automated match to d1s6la1
    complexed with br, po4, zn5

Details for d5u7ab1

PDB Entry: 5u7a (more details), 1.53 Å

PDB Description: crystal structure of a complex formed between merb and dimethyltin
PDB Compounds: (B:) Alkylmercury lyase

SCOPe Domain Sequences for d5u7ab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u7ab1 a.4.5.79 (B:1-80) Alkylmercury lyase MerB {Escherichia coli [TaxId: 562]}
mklapyilelltsvnrtngtadllvpllrelakgrpvsrttlagildwpaervaavleqa
tsteydkdgniigygltlre

SCOPe Domain Coordinates for d5u7ab1:

Click to download the PDB-style file with coordinates for d5u7ab1.
(The format of our PDB-style files is described here.)

Timeline for d5u7ab1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5u7ab2