Lineage for d5u1zb1 (5u1z B:1-360)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2896891Species Campylobacter jejuni [TaxId:197] [189298] (7 PDB entries)
  8. 2896903Domain d5u1zb1: 5u1z B:1-360 [328342]
    Other proteins in same PDB: d5u1za2, d5u1zb2, d5u1zc2
    automated match to d2ogea_
    complexed with cl, na

Details for d5u1zb1

PDB Entry: 5u1z (more details), 1.6 Å

PDB Description: x-ray structure of the wlarg aminotransferase, apo form, from campylobacter jejune
PDB Compounds: (B:) Putative aminotransferase

SCOPe Domain Sequences for d5u1zb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u1zb1 c.67.1.0 (B:1-360) automated matches {Campylobacter jejuni [TaxId: 197]}
mfflnlkqindrfntefitkfkeilesgwyilgkqcekfennfakycgvkhcigvangld
alrliikaydfkendeiivpantyiasilaitdnkckpiliepdintyninpdlieekit
kktkaimvvhlygqvcdmekiqllankynlkiiedcaqahgaiykdkrvgnlgdaagfsf
ypgknlgalgdagcictnddnfaskiralanygshkkyenlytglnsrldeiqaafldik
lkyldednnkrknianfylqnikneniilpsnkfdhvwhlfvvktklrdelqhylnnhdi
qtiihypipphkqkcykdlnhlklpitenihqevlslpisptmkendfkkvadilnkwkv

SCOPe Domain Coordinates for d5u1zb1:

Click to download the PDB-style file with coordinates for d5u1zb1.
(The format of our PDB-style files is described here.)

Timeline for d5u1zb1: