Lineage for d5u83b2 (5u83 B:81-208)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3011496Fold d.357: NosL/MerB-like [160386] (1 superfamily)
    unusual fold; comprises two structural repeats of beta(2)-alpha-beta motifs, forming separate beta-sheets; probable duplication
  4. 3011497Superfamily d.357.1: NosL/MerB-like [160387] (2 families) (S)
  5. 3011503Family d.357.1.2: MerB-like [160391] (1 protein)
    Pfam PF03243
  6. 3011504Protein Alkylmercury lyase MerB [160392] (1 species)
  7. 3011505Species Escherichia coli [TaxId:562] [160393] (17 PDB entries)
    Uniprot P77072 81-212
  8. 3011519Domain d5u83b2: 5u83 B:81-208 [328318]
    Other proteins in same PDB: d5u83a1, d5u83b1
    automated match to d1s6la2
    complexed with act, br, zn8

Details for d5u83b2

PDB Entry: 5u83 (more details), 1.61 Å

PDB Description: crystal structure of a merb-trimethytin complex.
PDB Compounds: (B:) Alkylmercury lyase

SCOPe Domain Sequences for d5u83b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u83b2 d.357.1.2 (B:81-208) Alkylmercury lyase MerB {Escherichia coli [TaxId: 562]}
tsyvfeiddrrlyawcaldtlifpaligrtarvsshcaatgapvsltvspseiqavepag
mavslvlpqeaadvrqsfcchvhffasvptaedwaskhqgleglaivsvheafglgqefn
rhllqtms

SCOPe Domain Coordinates for d5u83b2:

Click to download the PDB-style file with coordinates for d5u83b2.
(The format of our PDB-style files is described here.)

Timeline for d5u83b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5u83b1