Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.79: MerB N-terminal domain-like [158323] (1 protein) |
Protein Alkylmercury lyase MerB [158324] (1 species) |
Species Escherichia coli [TaxId:562] [158325] (17 PDB entries) Uniprot P77072 21-80 |
Domain d5u83b1: 5u83 B:1-80 [328317] Other proteins in same PDB: d5u83a2, d5u83b2 automated match to d1s6la1 complexed with act, br, zn8 |
PDB Entry: 5u83 (more details), 1.61 Å
SCOPe Domain Sequences for d5u83b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5u83b1 a.4.5.79 (B:1-80) Alkylmercury lyase MerB {Escherichia coli [TaxId: 562]} mklapyilelltsvnrtngtadllvpllrelakgrpvsrttlagildwpaervaavleqa tsteydkdgniigygltlre
Timeline for d5u83b1: