Lineage for d5u1zd_ (5u1z D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2504326Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2504327Protein automated matches [190151] (160 species)
    not a true protein
  7. 2504539Species Campylobacter jejuni [TaxId:197] [189298] (7 PDB entries)
  8. 2504553Domain d5u1zd_: 5u1z D: [328314]
    Other proteins in same PDB: d5u1za2, d5u1zb2, d5u1zc2
    automated match to d2ogea_
    complexed with cl, na

Details for d5u1zd_

PDB Entry: 5u1z (more details), 1.6 Å

PDB Description: x-ray structure of the wlarg aminotransferase, apo form, from campylobacter jejune
PDB Compounds: (D:) Putative aminotransferase

SCOPe Domain Sequences for d5u1zd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u1zd_ c.67.1.0 (D:) automated matches {Campylobacter jejuni [TaxId: 197]}
mfflnlkqindrfntefitkfkeilesgwyilgkqcekfennfakycgvkhcigvangld
alrliikaydfkendeiivpantyiasilaitdnkckpiliepdintyninpdlieekit
kktkaimvvhlygqvcdmekiqllankynlkiiedcaqahgaiykdkrvgnlgdaagfsf
ypgknlgalgdagcictnddnfaskiralanygshkkyenlytglnsrldeiqaafldik
lkyldednnkrknianfylqnikneniilpsnkfdhvwhlfvvktklrdelqhylnnhdi
qtiihypipphkqkcykdlnhlklpitenihqevlslpisptmkendfkkvadilnkwk

SCOPe Domain Coordinates for d5u1zd_:

Click to download the PDB-style file with coordinates for d5u1zd_.
(The format of our PDB-style files is described here.)

Timeline for d5u1zd_: