SCOPe 2.08: Domain d5u7cb2: 5u7c B:81-208

Lineage for d5u7cb2 (5u7c B:81-208)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.357: NosL/MerB-like [160386] (1 superfamily)
   unusual fold; comprises two structural repeats of beta(2)-alpha-beta motifs, forming separate beta-sheets; probable duplication

4. Superfamily d.357.1: NosL/MerB-like [160387] (2 families)

5. Family d.357.1.2: MerB-like [160391] (1 protein)
   Pfam PF03243

6. Protein Alkylmercury lyase MerB [160392] (1 species)

7. Species Escherichia coli [TaxId:562] [160393] (17 PDB entries)
   Uniprot P77072 81-212

8. Domain d5u7cb2: 5u7c B:81-208 [328306]
   Other proteins in same PDB: d5u7ca1, d5u7cb1
   automated match to d1s6la2
   complexed with act, br, zn7

Details for d5u7cb2

PDB Entry: 5u7c, 1.75 Å

PDB Description: crystal structure of the lead-bound form of merb formed from diethyllead.

PDB Compounds: (B:) Alkylmercury lyase

SCOPe Domain Sequences for d5u7cb2:

Sequence; same for both SEQRES and ATOM records:

>d5u7cb2 d.357.1.2 (B:81-208) Alkylmercury lyase MerB {Escherichia coli [TaxId: 562]}
tsyvfeiddrrlyawcaldtlifpaligrtarvsshcaatgapvsltvspseiqavepag
mavslvlpqeaadvrqsfcchvhffasvptaedwaskhqgleglaivsvheafglgqefn
rhllqtms

Timeline for d5u7cb2:

• d5u7cb2 first appeared in SCOPe 2.06
  
• d5u7cb2 appears in SCOPe 2.07