Lineage for d6gssb2 (6gss B:2-76)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24115Fold c.47: Thioredoxin fold [52832] (3 superfamilies)
  4. 24116Superfamily c.47.1: Thioredoxin-like [52833] (10 families) (S)
  5. 24235Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (2 proteins)
  6. 24236Protein Glutathione S-transferase [52863] (22 species)
  7. 24307Species Human (Homo sapiens), class pi [TaxId:9606] [52864] (30 PDB entries)
  8. 24328Domain d6gssb2: 6gss B:2-76 [32829]
    Other proteins in same PDB: d6gssa1, d6gssb1

Details for d6gssb2

PDB Entry: 6gss (more details), 1.9 Å

PDB Description: human glutathione s-transferase p1-1, complex with glutathione

SCOP Domain Sequences for d6gssb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gssb2 c.47.1.5 (B:2-76) Glutathione S-transferase {Human (Homo sapiens), class pi}
pytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdlt
lyqsntilrhlgrtl

SCOP Domain Coordinates for d6gssb2:

Click to download the PDB-style file with coordinates for d6gssb2.
(The format of our PDB-style files is described here.)

Timeline for d6gssb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6gssb1