SCOPe 2.08: Domain d5t2za_: 5t2z A:

Lineage for d5t2za_ (5t2z A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein automated matches [190433] (12 species)
   not a true protein

7. Species Human immunodeficiency virus 1 [TaxId:11676] [187327] (32 PDB entries)

8. Domain d5t2za_: 5t2z A: [328234]
   automated match to d4njsa_
   complexed with 017

Details for d5t2za_

PDB Entry: 5t2z, 1.5 Å

PDB Description: crystal structure of multi-drug resistant hiv-1 protease pr-s17 in complex with darunavir

PDB Compounds: (A:) Protease

SCOPe Domain Sequences for d5t2za_:

Sequence; same for both SEQRES and ATOM records:

>d5t2za_ b.50.1.1 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
pqitlwqrpivtikiggqlrealldtgaddtvledidlpgrwkpklivgiggfvkvrqye
qvpieiaghkvvgtvligptpsniigrnlmtqlgatlnf

Timeline for d5t2za_:

• d5t2za_ first appeared in SCOPe 2.06
  
• d5t2za_ appears in SCOPe 2.07