Lineage for d17gsb2 (17gs B:2-76)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1852841Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 1853156Protein Class pi GST [81358] (4 species)
  7. 1853157Species Human (Homo sapiens) [TaxId:9606] [52864] (49 PDB entries)
  8. 1853183Domain d17gsb2: 17gs B:2-76 [32819]
    Other proteins in same PDB: d17gsa1, d17gsb1
    complexed with gtx, mes

Details for d17gsb2

PDB Entry: 17gs (more details), 1.9 Å

PDB Description: glutathione s-transferase p1-1
PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d17gsb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d17gsb2 c.47.1.5 (B:2-76) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
pytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpafqdgdlt
lyqsntilrhlgrtl

SCOPe Domain Coordinates for d17gsb2:

Click to download the PDB-style file with coordinates for d17gsb2.
(The format of our PDB-style files is described here.)

Timeline for d17gsb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d17gsb1