SCOP 1.73: Domain d17gsb2: 17gs B:2-76

Lineage for d17gsb2 (17gs B:2-76)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (22 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)

6. Protein Class pi GST [81358] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52864] (39 PDB entries)

8. Domain d17gsb2: 17gs B:2-76 [32819]
   Other proteins in same PDB: d17gsa1, d17gsb1
   complexed with gtx, mes; mutant

Details for d17gsb2

PDB Entry: 17gs, 1.9 Å

PDB Description: glutathione s-transferase p1-1

PDB Compounds: (B:) glutathione s-transferase

SCOP Domain Sequences for d17gsb2:

Sequence; same for both SEQRES and ATOM records:

>d17gsb2 c.47.1.5 (B:2-76) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
pytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpafqdgdlt
lyqsntilrhlgrtl

Timeline for d17gsb2:

• d17gsb2 first appeared (with stable ids) in SCOP 1.55
  
• d17gsb2 appears in SCOP 1.71
  
• d17gsb2 appears in SCOP 1.75
  
• d17gsb2 appears in the current release, SCOPe 2.08