SCOPe 2.08: Domain d5tera2: 5ter A:430-552

Lineage for d5tera2 (5ter A:430-552)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (40 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 group m subtype b (isolate bh10) [TaxId:11678] [275362] (22 PDB entries)

8. Domain d5tera2: 5ter A:430-552 [328189]
   Other proteins in same PDB: d5tera1, d5terb_
   automated match to d1dloa1
   protein/DNA complex; complexed with 7ay, mg, so4

Details for d5tera2

PDB Entry: 5ter, 2.7 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase in complex with 5- chloro-7-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy) phenoxy)-8-methyl-2-naphthonitrile (jlj651), a non-nucleoside inhibitor

PDB Compounds: (A:) HIV-1 reverse transcriptase, p66 subunit

SCOPe Domain Sequences for d5tera2:

Sequence; same for both SEQRES and ATOM records:

>d5tera2 c.55.3.0 (A:430-552) automated matches {Human immunodeficiency virus type 1 group m subtype b (isolate bh10) [TaxId: 11678]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klv

Timeline for d5tera2:

• d5tera2 first appeared in SCOPe 2.06
  
• d5tera2 appears in SCOPe 2.07