SCOPe 2.08: Domain d17gsa2: 17gs A:0-76

Lineage for d17gsa2 (17gs A:0-76)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class pi GST [81358] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52864] (64 PDB entries)

8. Domain d17gsa2: 17gs A:0-76 [32818]
   Other proteins in same PDB: d17gsa1, d17gsb1
   complexed with gtx, mes

Details for d17gsa2

PDB Entry: 17gs, 1.9 Å

PDB Description: glutathione s-transferase p1-1

PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d17gsa2:

Sequence; same for both SEQRES and ATOM records:

>d17gsa2 c.47.1.5 (A:0-76) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
mppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpafqdgd
ltlyqsntilrhlgrtl

Timeline for d17gsa2:

• d17gsa2 first appeared (with stable ids) in SCOP 1.55
  
• d17gsa2 appears in SCOPe 2.07