Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily) core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest |
Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (1 family) automatically mapped to Pfam PF00510 |
Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins) function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel |
Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [81444] (37 PDB entries) |
Domain d5iy5c_: 5iy5 C: [328172] Other proteins in same PDB: d5iy51_, d5iy52_, d5iy5a_, d5iy5b1, d5iy5b2, d5iy5d_, d5iy5e_, d5iy5f_, d5iy5g_, d5iy5h_, d5iy5i_, d5iy5j_, d5iy5k_, d5iy5l_, d5iy5m_, d5iy5n_, d5iy5o1, d5iy5o2, d5iy5q_, d5iy5r_, d5iy5s_, d5iy5t_, d5iy5u_, d5iy5v_, d5iy5w_, d5iy5x_, d5iy5y_, d5iy5z_ automated match to d3ag3c_ complexed with cdl, chd, cu, cua, dmu, edo, hea, hem, mg, na, pek, per, pgv, psc, tgl, unl, zn |
PDB Entry: 5iy5 (more details), 2 Å
SCOPe Domain Sequences for d5iy5c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5iy5c_ f.25.1.1 (C:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]} hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw hfvdvvwlflyvsiywwgs
Timeline for d5iy5c_:
View in 3D Domains from other chains: (mouse over for more information) d5iy51_, d5iy52_, d5iy5a_, d5iy5b1, d5iy5b2, d5iy5d_, d5iy5e_, d5iy5f_, d5iy5g_, d5iy5h_, d5iy5i_, d5iy5j_, d5iy5k_, d5iy5l_, d5iy5m_, d5iy5n_, d5iy5o1, d5iy5o2, d5iy5p_, d5iy5q_, d5iy5r_, d5iy5s_, d5iy5t_, d5iy5u_, d5iy5v_, d5iy5w_, d5iy5x_, d5iy5y_, d5iy5z_ |