SCOPe 2.05: Domain d8gssc2: 8gss C:1-76

Lineage for d8gssc2 (8gss C:1-76)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class pi GST [81358] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52864] (49 PDB entries)

8. Domain d8gssc2: 8gss C:1-76 [32817]
   Other proteins in same PDB: d8gssa1, d8gssb1, d8gssc1
   complexed with gsh, mes, so4

Details for d8gssc2

PDB Entry: 8gss, 1.9 Å

PDB Description: Human glutathione S-transferase P1-1, complex with glutathione

PDB Compounds: (C:) glutathione s-transferase p1-1

SCOPe Domain Sequences for d8gssc2:

Sequence; same for both SEQRES and ATOM records:

>d8gssc2 c.47.1.5 (C:1-76) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
tlyqsntilrhlgrtl

Timeline for d8gssc2:

• d8gssc2 first appeared (with stable ids) in SCOP 1.55
  
• d8gssc2 appears in SCOPe 2.04
  
• d8gssc2 appears in SCOPe 2.06
  
• d8gssc2 appears in the current release, SCOPe 2.08