Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
Protein automated matches [190039] (158 species) not a true protein |
Species Brucella abortus [TaxId:359391] [328149] (2 PDB entries) |
Domain d5teub1: 5teu B:25-304 [328150] Other proteins in same PDB: d5teua2, d5teub2 automated match to d4ne4a_ complexed with act, so4, tla |
PDB Entry: 5teu (more details), 1.62 Å
SCOPe Domain Sequences for d5teub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5teub1 c.94.1.0 (B:25-304) automated matches {Brucella abortus [TaxId: 359391]} qvavsskidteggvlgniiltvlnangikttdriqlgatpvvrkaitageidiypeytgn aafffnkaddplwkdpakayetakkldydankivwltpspanntwgiavrkdvanenkla slsdfgkyiagggkvvlaassefvnsaaalpafqtaygftlkpdqlitlsggdtaatiaa aanqtnganaamvygtdggiapsglvvleddkhvqpvyqpapiireevlkkdpkieellk pvfekldlttlqdlngrvqlggepakavaedflkkngflk
Timeline for d5teub1: