Lineage for d5teub1 (5teu B:25-304)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2915314Species Brucella abortus [TaxId:359391] [328149] (2 PDB entries)
  8. 2915316Domain d5teub1: 5teu B:25-304 [328150]
    Other proteins in same PDB: d5teua2, d5teub2
    automated match to d4ne4a_
    complexed with act, so4, tla

Details for d5teub1

PDB Entry: 5teu (more details), 1.62 Å

PDB Description: brucella periplasmic binding protein yehz
PDB Compounds: (B:) Substrate-binding region of ABC-type glycine betaine transport system

SCOPe Domain Sequences for d5teub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5teub1 c.94.1.0 (B:25-304) automated matches {Brucella abortus [TaxId: 359391]}
qvavsskidteggvlgniiltvlnangikttdriqlgatpvvrkaitageidiypeytgn
aafffnkaddplwkdpakayetakkldydankivwltpspanntwgiavrkdvanenkla
slsdfgkyiagggkvvlaassefvnsaaalpafqtaygftlkpdqlitlsggdtaatiaa
aanqtnganaamvygtdggiapsglvvleddkhvqpvyqpapiireevlkkdpkieellk
pvfekldlttlqdlngrvqlggepakavaedflkkngflk

SCOPe Domain Coordinates for d5teub1:

Click to download the PDB-style file with coordinates for d5teub1.
(The format of our PDB-style files is described here.)

Timeline for d5teub1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5teub2