Lineage for d1aqwd2 (1aqw D:1-76)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 584500Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 584501Superfamily c.47.1: Thioredoxin-like [52833] (16 families) (S)
  5. 584721Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)
  6. 584951Protein Class pi GST [81358] (4 species)
  7. 584952Species Human (Homo sapiens) [TaxId:9606] [52864] (36 PDB entries)
  8. 584956Domain d1aqwd2: 1aqw D:1-76 [32814]
    Other proteins in same PDB: d1aqwa1, d1aqwb1, d1aqwc1, d1aqwd1
    complexed with ilg, mes

Details for d1aqwd2

PDB Entry: 1aqw (more details), 1.8 Å

PDB Description: glutathione s-transferase in complex with glutathione

SCOP Domain Sequences for d1aqwd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aqwd2 c.47.1.5 (D:1-76) Class pi GST {Human (Homo sapiens)}
ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
tlyqsntilrhlgrtl

SCOP Domain Coordinates for d1aqwd2:

Click to download the PDB-style file with coordinates for d1aqwd2.
(The format of our PDB-style files is described here.)

Timeline for d1aqwd2: