SCOPe 2.07: Domain d5kwea1: 5kwe A:3-254

Lineage for d5kwea1 (5kwe A:3-254)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (309 species)
   not a true protein

7. Species Agrobacterium tumefaciens [TaxId:358] [193697] (5 PDB entries)

8. Domain d5kwea1: 5kwe A:3-254 [328133]
   Other proteins in same PDB: d5kwea2, d5kweb2, d5kwec2, d5kwed2
   automated match to d3zn2a_
   complexed with cl, na; mutant

Details for d5kwea1

PDB Entry: 5kwe, 1.68 Å

PDB Description: thermostable mutant of halohydrin dehalogenase hhec - c153n

PDB Compounds: (A:) halohydrin dehalogenase

SCOPe Domain Sequences for d5kwea1:

Sequence; same for both SEQRES and ATOM records:

>d5kwea1 c.2.1.0 (A:3-254) automated matches {Agrobacterium tumefaciens [TaxId: 358]}
taivtnvkhfggmgsalrlseaghtvachdesfkqkdeleafaetypqlkpmseqepael
ieavtsaygqvdvlvsndifapefqpidkyavedyrgavealqirpfalvnavasqmkkr
ksghiifitsatpfgpwkelstytsaragantlanalskelgeynipvfaigpnylhsed
spyfyptepwktnpehvahvkkvtalqrlgtqkelgelvaflasgscdyltgqvfwlagg
fpmierwpgmpe

Timeline for d5kwea1:

• d5kwea1 first appeared in SCOPe 2.06
  
• d5kwea1 appears in the current release, SCOPe 2.08