Lineage for d1aqwb2 (1aqw B:1-76)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the restSuperfamily c.47.1: Thioredoxin-like [52833] (24 families) 
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) 
Protein Class pi GST [81358] (4 species) 
Species Human (Homo sapiens) [TaxId:9606] [52864] (63 PDB entries) 
Domain d1aqwb2: 1aqw B:1-76 [32812]
Other proteins in same PDB: d1aqwa1, d1aqwb1, d1aqwc1, d1aqwd1
complexed with gsh, mes
Details for d1aqwb2
PDB Entry: 1aqw (more details), 1.8 Å
PDB Description: glutathione s-transferase in complex with glutathione
PDB Compounds: (B:) glutathione s-transferaseSCOPe Domain Sequences for d1aqwb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aqwb2 c.47.1.5 (B:1-76) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
tlyqsntilrhlgrtl
SCOPe Domain Coordinates for d1aqwb2:
Click to download the PDB-style file with coordinates for d1aqwb2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1aqwb2:
View in 3D
