SCOP 1.73: Domain d1aqwa2: 1aqw A:1-76

Lineage for d1aqwa2 (1aqw A:1-76)

Root: SCOP 1.73
Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
Superfamily c.47.1: Thioredoxin-like [52833] (22 families)
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
Protein Class pi GST [81358] (4 species)
Species Human (Homo sapiens) [TaxId:9606] [52864] (39 PDB entries)
Domain d1aqwa2: 1aqw A:1-76 [32811]
Other proteins in same PDB: d1aqwa1, d1aqwb1, d1aqwc1, d1aqwd1

Details for d1aqwa2

PDB Entry: 1aqw (more details), 1.8 Å

PDB Description: glutathione s-transferase in complex with glutathione

PDB Compounds: (A:) glutathione s-transferase

SCOP Domain Sequences for d1aqwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aqwa2 c.47.1.5 (A:1-76) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
tlyqsntilrhlgrtl

SCOP Domain Coordinates for d1aqwa2:

Click to download the PDB-style file with coordinates for d1aqwa2.
(The format of our PDB-style files is described here.)

Timeline for d1aqwa2: